DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG16998

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:276 Identity:74/276 - (26%)
Similarity:125/276 - (45%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |:.:.|::||            |.|:.|.. ....:||:||........|:..|:. :.|.:||.
  Fly     1 MNILALILLL------------ICGHKTSA-LSPQERIVGGVEVPIHLTPWLASIT-VHGNYSCS 51

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGG-RYFLKAIHIHCNYDNPEMHNDIALLE 129
            .|:|...:::||.|||:   .|....|...:.:...|| |..:.::.:|.:::...:.||||||:
  Fly    52 SALITSLWLVTAGHCVQ---YPDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLK 113

  Fly   130 LVEPIAWDERTQ--PIPLPLVPMQPGDEVILTGWGS-TVLWGTSPIDLQVLYLQYVPHRECKAL- 190
            |.:........|  .:|||.:.:.| ..:::.|||: ......|...|:...::.:..|.|:.| 
  Fly   114 LDKSFTLGGNIQVVKLPLPSLNILP-RTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLY 177

  Fly   191 ------LSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASV 248
                  :::|..|..|       .|...|:||||.|||..|...|:|::...|| ...|.|:..:
  Fly   178 SHLHRPITDDMVCAAG-------AGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRL 235

  Fly   249 YFYRDWIRNVMSGNSK 264
            ..|..||.||:..:.|
  Fly   236 ANYVTWIFNVLENDRK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 62/229 (27%)
Tryp_SPc 38..258 CDD:238113 63/231 (27%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 62/229 (27%)
Tryp_SPc 25..242 CDD:238113 61/228 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.