DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and sphinx2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:309 Identity:74/309 - (23%)
Similarity:119/309 - (38%) Gaps:97/309 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQ-ISLQGISGAHS- 63
            |..||.|::|      |:|....:.|..      ..||.||..|:    ||. |.|.||..|.| 
  Fly     1 MKLVVALLVL------SLTFSVCEKNKL------SPRITGGYRAK----PYTIIYLVGIVYAKSP 49

  Fly    64 ------CGGAIINETFVLTAAHCV-----------ENAFIPWLVVVTGTNKYNQPGGRYFLKAIH 111
                  ..|.||:..::||....:           :.||..:.::            |.:.:..:
  Fly    50 LSSLKFGAGTIISNQWILTVKEVLIFKYIEAHFGSKRAFWGYDIL------------RIYRENFY 102

  Fly   112 IHCNYDNPEMHNDIALLELVEPI-AWDERTQPIPLPLVPMQ----PGDEVILTGWGSTVLWGTSP 171
            .|  ||...:   |||::.  |. .:|.|...:.:|....:    .|:..::.|||:.......|
  Fly   103 FH--YDKTRI---IALVKC--PYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLP 160

  Fly   172 -----IDLQVLYLQYVPHRECKALLSNDEDCDVGH-------ICTFSRLGEGACHGDSGGPLVS- 223
                 ::::|:               |:.:|...|       :||.....:|.|.||.||.:|: 
  Fly   161 TWMRCVEVEVM---------------NNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTM 210

  Fly   224 --NGYLVGLVNWGWP--CATGVPDVHASVYFYRDWIRNVMSGNSKCTGF 268
              |...:|:: |..|  |:.|.|.||..|..:..||::| ||    .||
  Fly   211 GPNPTFIGII-WLMPTNCSIGYPSVHIRVSDHIKWIKHV-SG----VGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 59/258 (23%)
Tryp_SPc 38..258 CDD:238113 60/260 (23%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 59/258 (23%)
Tryp_SPc 26..248 CDD:304450 60/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.