DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG10469

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:263 Identity:79/263 - (30%)
Similarity:124/263 - (47%) Gaps:58/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISL----QGISG-AHSCGGAIINETFVLTAAHCVENAFIP----WLVVV 92
            ||:.|.||:....|||:.|    :|... .:.|||.|::..:::|||||:::   |    |.|::
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQD---PKSNLWKVLI 84

  Fly    93 ------TGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLV-PM 150
                  :..:|.......|.:    :|..:|...:.|||||::|.:.:.:::..||..||.. ..
  Fly    85 HVGKVKSFDDKEIVVNRSYTI----VHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKT 145

  Fly   151 QPGDEVILTGWGSTVLWGTSPIDLQVLYLQY-----VPHREC------------KALLSNDEDCD 198
            ..|.:.|::|||.|    |..:..||  |||     :.::||            |.::.|     
  Fly   146 YTGRKAIISGWGLT----TKQLPSQV--LQYIRAPIISNKECERQWNKQLGGKSKKVVHN----- 199

  Fly   199 VGHICTFSRLGEGACHGDSGGPLV---SNGYLVGLVNWGW--PCATGVPDVHASVYFYRDWIRNV 258
             |.||..|:.|. .|.||||||:|   .:..|||:|:.|:  .|...:|||...|..|..||:..
  Fly   200 -GFICIDSKKGL-PCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYY 262

  Fly   259 MSG 261
            ..|
  Fly   263 SGG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/255 (30%)
Tryp_SPc 38..258 CDD:238113 77/257 (30%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 76/255 (30%)
Tryp_SPc 24..260 CDD:238113 76/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.