DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG10472

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:292 Identity:86/292 - (29%)
Similarity:127/292 - (43%) Gaps:57/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVVLLI--LLGLSGL----VSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQIS--LQGIS 59
            |.|||:  :||...:    |....|........|......||.|||.||....|||:.  |....
  Fly     6 ATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITG 70

  Fly    60 GAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY---------NQPGGRYFL---KAIHI 112
            ||..|||.||::.:::|||||.::       :.||.:.|         .:.|.:...   |.:.:
  Fly    71 GAAWCGGTIISDRWIITAAHCTDS-------LTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIV 128

  Fly   113 HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL----VPMQPGDEVILTGWGSTVLWGTSPID 173
            |.::....:.|||:|::|..||.:::..||..||:    .....|:..|.:|||......|...|
  Fly   129 HEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATD 193

  Fly   174 LQVLYLQY--VPHRECKALLSNDEDCD--------VGHICTFSRLGEGACHGDSGGPLV---SNG 225
            :    |||  ||       :.|:..|.        ..:||..:..|...|:||||||||   .:.
  Fly   194 I----LQYATVP-------IMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSN 247

  Fly   226 YLVGLVNWG--WPCATGVPDVHASVYFYRDWI 255
            .|:|..::|  ..|..|.|.|...:.:|.|||
  Fly   248 TLIGATSFGIALGCEVGWPGVFTRITYYLDWI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/250 (30%)
Tryp_SPc 38..258 CDD:238113 76/251 (30%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 75/250 (30%)
Tryp_SPc 47..282 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.