DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and yip7

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:292 Identity:83/292 - (28%)
Similarity:122/292 - (41%) Gaps:63/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSG----LVSITAI----RIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQG 57
            |...|:|:|...|.    |.:|..:    |:...|..|      ||..|:.|..|..|||:.|..
  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITG------RITNGKDAVAGQFPYQVGLSF 59

  Fly    58 ISGAHS--CGGAIINETFVLTAAHCVENA------------FIPWLVVVTGTNKYNQPGGRYFLK 108
            .|.|.|  |||:||...:|||||||.:.|            ..|....|..::|:.|        
  Fly    60 SSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQ-------- 116

  Fly   109 AIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLV----PMQPGDEVILTGWGSTVLWGT 169
                |.:|....:.|||:|:: ...:::......|.||.|    ....|...:.:|||.|....|
  Fly   117 ----HESYLALTIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQAT 176

  Fly   170 S-PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRL-------GEGACHGDSGGPLVSNGY 226
            : ..|||.:.|..:.:.:|:...        |.:...||:       ....|.|||||||..:|.
  Fly   177 AVSRDLQYVDLTIISNSKCQETF--------GSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGV 233

  Fly   227 LVGLVNWGWP--CATGVPDVHASVYFYRDWIR 256
            |:|..::|..  |.:|.|.....:.:|||||:
  Fly   234 LIGATSFGSADGCESGAPAAFTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/245 (29%)
Tryp_SPc 38..258 CDD:238113 72/247 (29%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 71/245 (29%)
Tryp_SPc 40..267 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.