DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG10477

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:247 Identity:75/247 - (30%)
Similarity:106/247 - (42%) Gaps:31/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS--CGGAIINETFVLTAAHCVENAFIPWL 89
            |.|||...     |.:||.:.| |||:.|...|.|.|  |||:||..|:|||||||.:.|....:
  Fly    35 SIDGRITN-----GNKAAANQF-PYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTI 93

  Fly    90 ----VVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPM 150
                .|.|......:.....|::    |..|:...:.|||:|:: ...:.:......|.||.:..
  Fly    94 YYGSTVRTSAKLKKKVSSSKFVQ----HAGYNAATLRNDISLIK-TPSVTFTVSINKIALPAIAS 153

  Fly   151 Q----PGDEVILTGWGSTVLWGTSPI----DLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSR 207
            .    .|...:.:|||.|   ..|.|    :||....|.:.:..|:....:.. ...|.||..|.
  Fly   154 SYSTYAGQTAVASGWGRT---SDSSIAVATNLQYAQFQVITNAVCQKTFGSSV-VTSGVICVESI 214

  Fly   208 LGEGACHGDSGGPLVSNGYLVGLVNW--GWPCATGVPDVHASVYFYRDWIRN 257
            ..:..|.|||||||..|..|:|:.::  ...|....|.....|..|.|||:|
  Fly   215 NKKSTCQGDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/233 (29%)
Tryp_SPc 38..258 CDD:238113 71/236 (30%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 69/239 (29%)
Tryp_SPc 40..267 CDD:238113 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.