DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG32277

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:287 Identity:71/287 - (24%)
Similarity:119/287 - (41%) Gaps:70/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSITAIRIKGNSTDGRF-YKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIIN 70
            ::|:||:.|     .:::|:|.   | .:..:|.||:........:.::|:. .|...|||.||:
  Fly     3 ILLIGLALL-----HQLEGSSL---FTLRQGKIFGGKTTLVKDHSFLVNLRR-GGKFRCGGVIIS 58

  Fly    71 ETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRY-FLKAIHIHCNY-----DNPEMH------- 122
            ...|||||||:|                    ||| .::.:.:|...     |.|..|       
  Fly    59 PNCVLTAAHCLE--------------------GRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYV 103

  Fly   123 -------------NDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGST----VLWGTS 170
                         :|:|::.|..|.........:.:....:.|...:.:.|||:.    ..|...
  Fly   104 GLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQC 168

  Fly   171 PIDLQVLYLQYVPHREC-KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG 234
               ||...::.:.|||| |::.|..:.......|...:....||.||||||.:..|..||:|:||
  Fly   169 ---LQEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVSWG 230

  Fly   235 WPCATGVPDVHASV------YFYRDWI 255
            :.|.:|.|.|:..:      |:.:|:|
  Fly   231 YGCGSGYPGVYTRLSSPSITYWLKDFI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 63/254 (25%)
Tryp_SPc 38..258 CDD:238113 64/255 (25%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 61/243 (25%)
Tryp_SPc 27..246 CDD:238113 61/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.