DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and KLK2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_005542.1 Gene:KLK2 / 3817 HGNCID:6363 Length:261 Species:Homo sapiens


Alignment Length:296 Identity:86/296 - (29%)
Similarity:123/296 - (41%) Gaps:76/296 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILL--GLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGG 66
            :||.|.|  |.:|.|.:.               ..||:||...|....|:|:::.....|| |||
Human     4 LVLSIALSVGCTGAVPLI---------------QSRIVGGWECEKHSQPWQVAVYSHGWAH-CGG 52

  Fly    67 AIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP---GGRYFLKAIHIHCNYD----------- 117
            .:::..:|||||||::.....||    |.:...:|   |.|..:.....|..|:           
Human    53 VLVHPQWVLTAAHCLKKNSQVWL----GRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRP 113

  Fly   118 NPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGS----TVLWGTSPIDLQVLY 178
            :.:..:|:.||.|.||....:..:.:.||......|.....:||||    ..|   .|..||.:.
Human   114 DEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFL---RPRSLQCVS 175

  Fly   179 LQYVPHRECKALLSNDEDCDVGHIC--TFSRL-------------GEGACHGDSGGPLVSNGYLV 228
            |.         |||||       :|  .:|..             |:..|.||||||||.||.|.
Human   176 LH---------LLSND-------MCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQ 224

  Fly   229 GLVNWG-WPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            |:.:|| .||| ...|.|:..|..||.||::.::.|
Human   225 GITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAAN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/252 (30%)
Tryp_SPc 38..258 CDD:238113 77/254 (30%)
KLK2NP_005542.1 Tryp_SPc 25..256 CDD:238113 77/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.