DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG3650

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:260 Identity:72/260 - (27%)
Similarity:121/260 - (46%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLGL-SGLVSITAIRIKGNSTDGRFYKDQRIIGGQ----AAEDGFAPYQISLQGISGAHSCGGA 67
            :|||| ||.:                  ..||:||.    :|..||.   ::|: ..|...|||:
  Fly    13 LLLGLASGQI------------------QPRIVGGTTTTLSAVGGFV---VNLR-YDGTFYCGGS 55

  Fly    68 IINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPG-----GRYFLKAIHIHCNYDNPEMHNDIAL 127
            ::..:.|:|||||::......:.|..|.:|.:|.|     .|||     |...:.:..::.|:.:
  Fly    56 LVTSSHVVTAAHCLKGYQASRITVQGGVSKLSQSGVVRRVARYF-----IPNGFSSSSLNWDVGV 115

  Fly   128 LELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPID-LQVLYLQYVPHRECKALL 191
            :.|...:.....| .|||..|...||:.:.::|||:|....:||.: |:.:.:|.:..:.|:...
  Fly   116 IRLQSALTGSGIT-TIPLCQVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAY 179

  Fly   192 SNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATG-VPDVHASVYFYRDWI 255
            ...:.......|..:. |:.:|.|||||.::....|.|:|:||..||.. .|.|:.||:..|.:|
  Fly   180 QGRDTLTASTFCARTG-GKDSCSGDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFI 243

  Fly   256  255
              Fly   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/228 (29%)
Tryp_SPc 38..258 CDD:238113 65/229 (28%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 65/228 (29%)
Tryp_SPc 26..243 CDD:238113 64/227 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.