DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG15873

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:294 Identity:78/294 - (26%)
Similarity:129/294 - (43%) Gaps:52/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLG--LSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAP--YQISLQGIS------ 59
            :|.:.||  ||..:|...:.:.|:.:|..|   :.:|.|     |:.|  .::|...:|      
  Fly     3 ILTVFLGLILSTSLSDADLGVIGDISDETF---EMLISG-----GYKPKSNRLSRHVVSIRTKNY 59

  Fly    60 -----GAHSCGGAIINETFVLTAAHCVENAFIPWL------VV---VTGTNKYNQPGGRYFLKAI 110
                 ..|.|.|.:::...|||||||:.:.:...:      ||   :|....|::...|...:.:
  Fly    60 VRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLV 124

  Fly   111 HIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP-----GDEVILTGWGSTVLWGTS 170
             :|..|:..: .||:|:|.|.|.:   :.:....|||:..:.     ||..|..|||.  ::...
  Fly   125 -VHPEYERYK-KNDLAILRLSERV---QSSNHDVLPLLMRKTANVTYGDTCITLGWGQ--IYQHG 182

  Fly   171 PIDLQVLYLQYV--PHRECKALLSNDEDCDVGH-ICTFSRLGEGA-CHGDSGGPLVSNGYLVGLV 231
            |...:::||..:  |...|:   .:.:.....| :|| ..:||.. |.||.||||:..|.|.||:
  Fly   183 PYSNELVYLDVILRPPSLCQ---KHYDTFTADHNVCT-EPVGESMNCAGDMGGPLLCKGALFGLI 243

  Fly   232 NWGWPCATGVPDVHASVYFYRDWIRNVMSGNSKC 265
            .....||.|......|..:|:|||...:...|.|
  Fly   244 GGHMGCAGGKAMKFLSFLYYKDWILLTIQSLSDC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/248 (26%)
Tryp_SPc 38..258 CDD:238113 67/250 (27%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 59/229 (26%)
Tryp_SPc 59..250 CDD:238113 53/201 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.