DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG30414

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:272 Identity:76/272 - (27%)
Similarity:110/272 - (40%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPG 102
            |.||..|.....|:.:.   :.|...|||::|...||||||||:.:..   :.|..|..|...||
  Fly    41 ITGGADAGLFSNPWMVK---VLGEKLCGGSLITSRFVLTAAHCIVSTH---MRVRLGEYKTRFPG 99

  Fly   103 --------GRYFLKAIH---------------------------IHCNYDNPEMHNDIALLELVE 132
                    ..|.|:.|.                           :|.:| |..:.|||.||.:..
  Fly   100 KDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADY-NLNLDNDIGLLRMKS 163

  Fly   133 PIAWDERTQPIPLPLVPMQPGDEVI--LTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDE 195
            .:.:.:..:||.| ||.....:..|  :||||.| ..||....||...:.......|::..:  :
  Fly   164 FVQYSDYVRPICL-LVEGHMAESPIFNITGWGVT-NDGTPSRRLQRATVYNTDLHFCRSKFT--K 224

  Fly   196 DCDVGHICTFSRLGEGACHGDSGGPLVSN--------GYLVGLVNWGWPCATGVPDVHASVYFYR 252
            ..|...||. :.....||||||||||.:.        .:..|||::| ..|.....|:.:|..:|
  Fly   225 QVDESQICA-AGTNSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYG-SAACHSFSVYTNVTHHR 287

  Fly   253 DWIRNVMSGNSK 264
            |||.|.:...|:
  Fly   288 DWIVNAIEDFSR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/261 (28%)
Tryp_SPc 38..258 CDD:238113 74/264 (28%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 72/261 (28%)
Tryp_SPc 41..290 CDD:238113 72/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.