DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG9897

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:261 Identity:70/261 - (26%)
Similarity:111/261 - (42%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            |||||.|.......||:..|:. ::....||||||::.::||||.||:......:.|..||:...
  Fly    20 DQRIINGNTVNIKDAPWYASII-VNSKLKCGGAIISKNYILTAAKCVDGYSARSIQVRLGTSSCG 83

  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGST 164
            ..|....:..:.:|..|.:....|::|||:..|.:...:..:||..............:||.|  
  Fly    84 TSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLNTTDEIKPIERADKVPDDNSRANVTGCG-- 146

  Fly   165 VLWGTS-----------------------PIDLQVLYLQYVPHRECKA--------LLSNDEDCD 198
               |.|                       |:.|....::.:..::|.|        ||....|..
  Fly   147 ---GRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADWKVIPFYLLKGISDLT 208

  Fly   199 VGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVMSGNS 263
               |||.|. |:|||..|.|.|||.:..|||:::.. .|:. .|||:|::..:.:|    :..|:
  Fly   209 ---ICTKSP-GKGACSTDRGSPLVIDNKLVGILSRA-GCSI-KPDVYANILGHTNW----LDSNT 263

  Fly   264 K 264
            |
  Fly   264 K 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/248 (26%)
Tryp_SPc 38..258 CDD:238113 65/250 (26%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 65/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.