DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG32833

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:235 Identity:58/235 - (24%)
Similarity:99/235 - (42%) Gaps:24/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGG 103
            :||.......||:..|: .|.....|.|||...:.::||..||:......:.|..|:...:....
  Fly    39 LGGHPVNITTAPWIASI-SIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTTRSDGVI 102

  Fly   104 RYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWG 168
            ...:..|.:|..:....:.:::|:|:|.||:...:..|||.|.......|.:|...||.|...|.
  Fly   103 EVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWPSFRWWA 167

  Fly   169 --------TSPIDLQVLYLQYVPHRECKALLSND--------EDCDVGHICTFSRLGEGACHGDS 217
                    .....||...::.:...:|..|.:.:        :|.    .|| .:..:.||....
  Fly   168 MYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDL----FCT-EKFAKEACSLAM 227

  Fly   218 GGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRN 257
            |.|:|.||.|||::..| .|:. .|:|:.::..|:||:.|
  Fly   228 GSPVVHNGKLVGIITKG-GCSE-YPEVYINLIKYKDWLHN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 56/231 (24%)
Tryp_SPc 38..258 CDD:238113 58/235 (25%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 58/234 (25%)
Tryp_SPc 40..262 CDD:214473 55/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.