DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG3700

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:267 Identity:76/267 - (28%)
Similarity:110/267 - (41%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQGISGAH-----------SCGGAIINETFVLTAAHCVE--------- 82
            |:||..|.....|:    ..:.|.|           .|||::::..||||||||:|         
  Fly   102 IVGGTKASGKEFPF----MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERL 162

  Fly    83 --NAFIPWLVVVTGTNKYNQPGGRYFLKAIH-----IHCNYDNPE----MHNDIALLELVEPIAW 136
              |...|..||..|...||.......::...     :|..||..:    ..|||||:||.....:
  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227

  Fly   137 DERTQPIPLPLVPMQPGD--EVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDV 199
            ::....:.||  |....|  :|...|||.|. .|.....|..:.||......|:..|....|...
  Fly   228 NDHVAAVCLP--PDSGNDVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRT 289

  Fly   200 GHICTFSRLGEG-ACHGDSGGPLVSNGYL-------VGLVNWGWPCAT-GVPDVHASVYFYRDWI 255
             ..|..|...:. .|:||||||:.....|       :|:|::|..|.: |:|.|:..|:.|.|||
  Fly   290 -QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353

  Fly   256 RNVMSGN 262
            .:::.||
  Fly   354 ESIVWGN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/258 (28%)
Tryp_SPc 38..258 CDD:238113 74/261 (28%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/261 (28%)
Tryp_SPc 102..353 CDD:214473 72/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.