DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG9294

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:252 Identity:72/252 - (28%)
Similarity:118/252 - (46%) Gaps:30/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            :|:|||.......|:...:. |.....|.|::||:.:|||||||||.  :|..::.....::|:.
  Fly   100 KIVGGQETRVHQYPWMAVIL-IYNRFYCSGSLINDLYVLTAAHCVEG--VPPELITLRFLEHNRS 161

  Fly   102 GG------RYFLKAIHIHCNYDNPEMHNDIALLELVEPIAW-DERTQPIPLPLVPMQPGDEV-IL 158
            ..      :.::..:.:|..|:.....||:|:|.|.:|:.. ..|.:||.||:.......|: |:
  Fly   162 HSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIV 226

  Fly   159 TGWGSTVLWGTSPIDLQVLYLQYVPHRECK-------ALLSNDEDCDVGHICTFSRLGEGACHGD 216
            .|||:....|.....|:.:.:..:|..||:       ..::::..| .|:|   |..|:.||.||
  Fly   227 AGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMC-AGYI---SEGGKDACSGD 287

  Fly   217 SGGPLVS-------NGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGNSKC 265
            |||||.:       ...|.|:|:||..|| ...|.|:..|..|..|:.:...|...|
  Fly   288 SGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNTPGGCHC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/240 (29%)
Tryp_SPc 38..258 CDD:238113 70/242 (29%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 69/239 (29%)
Tryp_SPc 101..334 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.