DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG30283

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:278 Identity:81/278 - (29%)
Similarity:124/278 - (44%) Gaps:41/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGLVSITAIRIKGNSTDGRFYKDQ---------RIIGGQAAEDGFAPYQISLQGISG 60
            |:::||..|.:|.:       .|..|.|.:..         :|:||..|....||:...:.|..|
  Fly     8 VVVVLLAASSVVVL-------GSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGG 65

  Fly    61 AHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDI 125
            .| |||.:|...||||:|||:.|.   .|.|..|..:......::.:.|:.:|.:|...:  :|:
  Fly    66 FH-CGGTLITNRFVLTSAHCIANG---ELKVRLGVLEREAEAQKFAVDAMFVHTDYYFDQ--HDL 124

  Fly   126 ALLELVEPIAWDERTQPIPLPLVPMQPG-DEVILT----GWGSTVLWGTSPIDLQVLYLQYVPHR 185
            |||.|.:.:.:.:...||.|.|.|:... ||.|:.    |||.|....:|.: ||...|..:...
  Fly   125 ALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRM-LQKTSLFNLHRS 188

  Fly   186 ECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPL--------VSNGYLVGLVNWGW-PCATGV 241
            || |.....:..:..|||..| .....|:|||||||        |...:..|:.::|. .|:...
  Fly   189 EC-AKQYPHQQINRNHICAES-ANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKAT 251

  Fly   242 PDVHASVYFYRDWIRNVM 259
              |..:|..:.|||.|.:
  Fly   252 --VFTNVMTHLDWIVNTV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/231 (30%)
Tryp_SPc 38..258 CDD:238113 72/233 (31%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 70/231 (30%)
Tryp_SPc 43..266 CDD:238113 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.