DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG10764

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:278 Identity:92/278 - (33%)
Similarity:131/278 - (47%) Gaps:27/278 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGI--SGAHS 63
            |.::|.:.||.|..|........|...|........:|.||   :|...|..|.:..|  |....
  Fly     1 MRSLVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGG---DDAAEPNSIWMAAIFNSSDFQ 62

  Fly    64 CGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALL 128
            |||.||:..|||:||||:...:.  |.|..|....|:|...:.:..:.:|.::...|..|||.||
  Fly    63 CGGTIIHMRFVLSAAHCLVRGYD--LYVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLL 125

  Fly   129 ELVEPIAWDERTQPIPLPLVPMQPGD-EVILT----GWGSTVLWGTSPIDLQVLYLQYVPHRECK 188
            :|.|.|.:..|.|||.:.|.|...|. |.:.|    |||:..  |...|.||.:||.::...|||
  Fly   126 QLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN--GKLSIMLQTIYLLHLKRNECK 188

  Fly   189 ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSN-------GYLV--GLVNWGWPCATGVPDV 244
            ..|  :.:.:...||..::.|: .|.|||||||.:|       .|.|  |:|::|.|...|| .|
  Fly   189 RKL--NFNLNSRQICAGTKNGD-TCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGV-GV 249

  Fly   245 HASVYFYRDWIRNVMSGN 262
            :..|..|.|||.:.::.|
  Fly   250 YTDVTSYVDWISSTIARN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 81/233 (35%)
Tryp_SPc 38..258 CDD:238113 83/235 (35%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 81/233 (35%)
Tryp_SPc 38..263 CDD:238113 83/235 (35%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.