DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG4927

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:284 Identity:87/284 - (30%)
Similarity:118/284 - (41%) Gaps:59/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RFYKDQR--------------IIGGQAAEDGFAPYQISLQGISGAHS------CGGAIINETFVL 75
            ||.|:.|              |:||..|.....|: ::|.|..|.:|      ||..||:..|||
  Fly    84 RFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPF-MALLGQRGKNSSQIDWDCGAIIIHPKFVL 147

  Fly    76 TAAHCVE-----------NAFIPWLVVVTGTNKYN------QPGGRYFLKAIHIHCNY----DNP 119
            |||||:|           |...|..||..|...||      ||.....|..: :|..|    |..
  Fly   148 TAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYV-VHPAYGEDDDTG 211

  Fly   120 EMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDE---VILTGWGSTVLWGTSPIDLQVLYLQY 181
            ...||||::||.....:.|...|..|||   ..|:|   |...|||:|...|.:...|..:.|..
  Fly   212 SRKNDIAVVELEMEATFSEYVAPACLPL---DGGNEQLQVAAAGWGATSESGHASSHLLKVSLDR 273

  Fly   182 VPHRECKALLSNDEDCDVGHICTFSR-LGEGACHGDSGGPLVSN-------GYLVGLVNWGWPCA 238
            ....||...|.:..|... .:|..|| .....|:||||||:...       ..::|:.::|..|.
  Fly   274 YDVAECSQRLEHKIDVRT-QLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCG 337

  Fly   239 T-GVPDVHASVYFYRDWIRNVMSG 261
            . |:|.|:..|:.|.|||.|::.|
  Fly   338 VQGLPSVYTKVHLYTDWIENIVWG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/270 (30%)
Tryp_SPc 38..258 CDD:238113 81/258 (31%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 81/258 (31%)
Tryp_SPc 105..355 CDD:214473 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.