DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss4

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:267 Identity:89/267 - (33%)
Similarity:128/267 - (47%) Gaps:38/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSG-LVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVL 75
            ||| |||:..:..      |:..|..|::||..|.....|:|:|:| .:..|.|||:|::..::|
  Rat   225 LSGSLVSLRCLDC------GKSLKTTRVVGGVEASADSWPWQVSIQ-YNKQHVCGGSILDHHWIL 282

  Fly    76 TAAHCVENAFIPWLVVVT-----GTNKY-NQPGGRYFLKAIHIHCNYDNP--EMHNDIALLELVE 132
            |||||    |..:|.|.:     |:||. |.|.    |....|.....||  ....||||::|..
  Rat   283 TAAHC----FRKYLDVSSWKVRAGSNKLGNSPS----LPVAKIFIAEPNPLQPKEKDIALVKLKM 339

  Fly   133 PIAWDERTQPIPLP-----LVPMQPGDEVILTGWGSTVLWGTSPID-LQVLYLQYVPHRECKALL 191
            |:.:....:||.||     |:|..|   |.:.|||.|...|....| |....:|.:....|.|..
  Rat   340 PLTFSGSVRPICLPFSDEELIPTMP---VWVIGWGFTEENGGKMSDTLLQASVQVIDSARCNAED 401

  Fly   192 SNDEDCDVGHICTFS-RLGEGACHGDSGGPLV---SNGYLVGLVNWGWPCAT-GVPDVHASVYFY 251
            :...:...|.:|..: :.|:..|.|||||||:   ....:||:|:||:.|.: ..|.|:..|..|
  Rat   402 AYQGEVTAGMLCAGTPQGGKDTCQGDSGGPLMYHYDKWQVVGIVSWGYGCGSPSTPGVYTKVTAY 466

  Fly   252 RDWIRNV 258
            .|||.||
  Rat   467 LDWIYNV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/236 (33%)
Tryp_SPc 38..258 CDD:238113 78/238 (33%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346 6/18 (33%)
Tryp_SPc 245..470 CDD:214473 77/236 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.