DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001004020.1 Gene:Tmprss11b / 365265 RGDID:1303278 Length:420 Species:Rattus norvegicus


Alignment Length:272 Identity:92/272 - (33%)
Similarity:134/272 - (49%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLSGLVSITAIRIKGNSTDGR-----FYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAII 69
            |.|:.:..:.|.:|..|....|     .|  .||.||..|:.|..|:|.||: ::|.|.||.::|
  Rat   158 LKLTEITKVDAEKIINNRCGRRPRMSATY--DRITGGSTAQKGEWPWQASLR-VNGKHHCGASLI 219

  Fly    70 NETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPI 134
            .|.|:||||||......|..:.|:...:......:::::.:.||.:|...:.|:|:|:::|.|.:
  Rat   220 GERFLLTAAHCFLRTNNPKNLTVSFGTRVTPAYMQHYVEEVIIHEDYVKGQHHDDVAIIKLTEKV 284

  Fly   135 AW---------DERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKAL 190
            ::         .|.||..|       ||:.|::|||||....|.||:.||...::.:....|   
  Rat   285 SFRNDVHRVCLPEATQVFP-------PGEGVVVTGWGSLSYNGKSPLLLQKASIKIIDTNAC--- 339

  Fly   191 LSNDEDCDVGHIC-TFSRLG--EG---ACHGDSGGPLVSNG-----YLVGLVNWGWPCA-TGVPD 243
              |.|:...|.|. |....|  ||   ||.||||||||...     ||||:|:||..|. ...|.
  Rat   340 --NSEEAYGGRIMDTMLCAGYMEGYVDACQGDSGGPLVHPNSRDIWYLVGIVSWGHECGRVNKPG 402

  Fly   244 VHASVYFYRDWI 255
            |:..|..|||||
  Rat   403 VYMRVTSYRDWI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 83/238 (35%)
Tryp_SPc 38..258 CDD:238113 84/239 (35%)
Tmprss11bNP_001004020.1 SEA 50..144 CDD:279699
Tryp_SPc 188..414 CDD:214473 83/238 (35%)
Tryp_SPc 189..417 CDD:238113 84/239 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.