DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Ser8

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:271 Identity:87/271 - (32%)
Similarity:130/271 - (47%) Gaps:34/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVV--LLILLGL-SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH 62
            ||.::  .|.||.| :|.|....:..:.:|..|      ||:||.|:.....|:|:|||. ||:|
  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGG------RIVGGTASSIEDRPWQVSLQR-SGSH 58

  Fly    63 SCGGAIINETFVLTAAHCVEN-AFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIA 126
            .|||:||:...::|||||::. ..:..|.:..|:||....|....:.||..|..|::....|||.
  Fly    59 FCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIG 123

  Fly   127 LLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC---- 187
            ::.|...:.:....:.|.:.......|....::|||.|...|.|...|..:..:.|...:|    
  Fly   124 VVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSST 188

  Fly   188 -------KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDV 244
                   ||.:          ||. :...:.||.|||||||||.|.|||:|:||..|| ...|.|
  Fly   189 YGYGSFIKATM----------ICA-AATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGV 242

  Fly   245 HASVYFYRDWI 255
            :|::...|||:
  Fly   243 YANIAELRDWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/230 (33%)
Tryp_SPc 38..258 CDD:238113 76/231 (33%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 76/230 (33%)
Tryp_SPc 35..253 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.