DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss56

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:257 Identity:75/257 - (29%)
Similarity:110/257 - (42%) Gaps:56/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAF--IPWLVVVTGTNKYN 99
            ||:||..|..|..|:.:.|| :.|...|||.::..::|||||||...|.  :.|.|::.     .
  Rat   111 RIVGGSTAPLGAWPWLVRLQ-LGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLA-----E 169

  Fly   100 QPGGRYF----LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP--GDEVIL 158
            .|.|...    :..|..|..:|....|||:||::|..|:..:...:||.||....:|  |....:
  Rat   170 GPQGEQAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVNSEGPARPICLPEGSREPPAGTPCTI 234

  Fly   159 TGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEG------------ 211
            .|||:  |:...|....|        ||.:..|.:.:.|.       ..||.|            
  Rat   235 AGWGA--LFEDGPESEAV--------REARVPLLSADTCQ-------KALGPGLSPSTMLCAGYL 282

  Fly   212 -----ACHGDSGGPLVSN-------GYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMS 260
                 :|.|||||||..:       ..|.|:.:||..|. .|.|.|:..|..::||::..||
  Rat   283 AGGIDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVAVFKDWLQEQMS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/250 (29%)
Tryp_SPc 38..258 CDD:238113 72/252 (29%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.