DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and thetaTry

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:263 Identity:90/263 - (34%)
Similarity:137/263 - (52%) Gaps:19/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68
            ||||:.|.:....:.|.    |.|....|.::.||:||:....|..|||:|||..||:|.|||::
  Fly     5 VVLLVCLAVGSACAGTV----GVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65

  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEP 133
            |||..|:|||||:....:..:.|..|:..||:.|....::.:..:.:|::..|..|:.:|:|.|.
  Fly    66 INEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEK 130

  Fly   134 IAWDERTQPIPLPLVPMQPGDEVILTGWGS-TVLW-GTSPIDLQVLYLQYVPHRECKALLSNDED 196
            :...|..:.|.|.......|...::||||| ...| .|.|..||.:|:..|..:.|.:     ::
  Fly   131 VKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCAS-----DE 190

  Fly   197 CDVGHI------CTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATG-VPDVHASVYFYRDW 254
            ...|.|      |.:.: .:.||.|||||||.....|||:|:||:.||:. :|.|::.|...|.|
  Fly   191 YKYGEIIYDSMVCAYEK-KKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKW 254

  Fly   255 IRN 257
            |.|
  Fly   255 ILN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/226 (35%)
Tryp_SPc 38..258 CDD:238113 80/229 (35%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 78/226 (35%)
Tryp_SPc 35..255 CDD:238113 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.