DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and etaTry

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:272 Identity:87/272 - (31%)
Similarity:130/272 - (47%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLIL--LGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ-----GI 58
            |:.|:|.||  |.|.|:.:::|      .:||      ||:||......:..|.:.|:     ..
  Fly     1 MNKVILRILAVLFLLGIYAVSA------QSDG------RIVGGADTSSYYTKYVVQLRRRSSSSS 53

  Fly    59 SGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYF-LKAIHIHCNYDNPEMH 122
            |.|.:|||.|::...:.||||||.|......:||.|.:......|... :..:..|..|::..|.
  Fly    54 SYAQTCGGCILDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMD 118

  Fly   123 NDIALLELVEPIAWDERTQPIPLPLVPMQP--GDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHR 185
            |||||:.:..|:..|..:....:.:...||  |.:..::|||.|...|.|...||.:.:..|...
  Fly   119 NDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSE 183

  Fly   186 ECKAL-----LSNDEDCDVGHICT-FSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPD 243
            :|:..     :|.      |.:|. .|..|:.||.||||||||....|.|:|:||..|| ...|.
  Fly   184 KCQEAYYWRPISE------GMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPG 242

  Fly   244 VHASVYFYRDWI 255
            |:|:|.:|:|||
  Fly   243 VYANVAYYKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/232 (32%)
Tryp_SPc 38..258 CDD:238113 75/233 (32%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 74/232 (32%)
Tryp_SPc 28..257 CDD:238113 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.