DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG12133

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:293 Identity:78/293 - (26%)
Similarity:112/293 - (38%) Gaps:83/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISG-------AHSCGGAIINETFVLTAAH 79
            |:.|.|....:     |:||..|:....|:.: |.|...       :..|.|::|...:||||||
  Fly    51 RVCGQSPPSSY-----IVGGMEAQSNQFPWTV-LLGYEAYTAKQRPSPMCAGSLIASRYVLTAAH 109

  Fly    80 CVE-NAFIPWLVVVTGTNKYNQP-------GGRYFLKAIHIHCNYD-----------NPEMHNDI 125
            |:. |.|....|.:...:..|.|       |.:.:..| |:..:.|           |...:|||
  Fly   110 CLNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPA-HVDIDVDLRVPHEQYYTRNGRHYNDI 173

  Fly   126 ALLELVEPIAWDERTQPIPLPLVPMQPGDEVI----------LTGWG-------STVL-----WG 168
            |||.|...:.:..:.:||.:     .||.|:.          :.|||       ||||     .|
  Fly   174 ALLRLKSRVKYTLQIRPICI-----WPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISG 233

  Fly   169 TSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPL---VSNG----- 225
            .||.:....|          ..|..|:|.   .||.....|.....||||.||   |..|     
  Fly   234 MSPDECLNRY----------PTLLVDKDI---QICAMGWDGTDTGLGDSGSPLMASVGRGADQFY 285

  Fly   226 YLVGLVNW-GWPCATGV-PDVHASVYFYRDWIR 256
            ||.|:.:: |.|.:.|. |.|:.....|.:||:
  Fly   286 YLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/275 (27%)
Tryp_SPc 38..258 CDD:238113 75/277 (27%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 75/277 (27%)
Tryp_SPc 62..317 CDD:214473 73/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.