DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:247 Identity:75/247 - (30%)
Similarity:120/247 - (48%) Gaps:30/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY 98
            |..|::||..|..|..|:|:||:. ...|.||..::.:.::|:||||..:..:..:....||...
Human   534 KPTRVVGGFGAASGEVPWQVSLKE-GSRHFCGATVVGDRWLLSAAHCFNHTKVEQVRAHLGTASL 597

  Fly    99 NQPGG---RYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLV----PMQPGDEV 156
            ...||   :..|:.:.:|..|:...:..|:|:|||..|:|:::..||:.|||.    |:  |.:.
Human   598 LGLGGSPVKIGLRRVVLHPLYNPGILDFDLAVLELASPLAFNKYIQPVCLPLAIQKFPV--GRKC 660

  Fly   157 ILTGWGSTVLW-GTSPIDLQVLYLQYVPHRECKALLS---NDEDCDVGHICTFSRLGEG---ACH 214
            :::|||:|... .|.|..||...:..:..:.|..|.:   .|.....|.:       ||   :|.
Human   661 MISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRMICAGFL-------EGKVDSCQ 718

  Fly   215 GDSGGPLVSNG-----YLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMS 260
            |||||||....     ||.|:|:||..|| ...|.|:..:...:.||..:||
Human   719 GDSGGPLACEEAPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILEIMS 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/237 (30%)
Tryp_SPc 38..258 CDD:238113 71/239 (30%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.