DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and f9a

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_878288.2 Gene:f9a / 359826 ZFINID:ZDB-GENE-030714-2 Length:503 Species:Danio rerio


Alignment Length:244 Identity:82/244 - (33%)
Similarity:116/244 - (47%) Gaps:27/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAH-SCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ 100
            |||||.:|..|..|:|::|...|... .|||:|:|..:|:|||||:.........:..|.:..::
Zfish   253 RIIGGNSALPGEIPWQVALVSRSTQQVFCGGSILNPLWVITAAHCLLGNHNGSFYIRVGEHDVSK 317

  Fly   101 PGGRY----FLKAIHIHCNYDNPE--MHNDIALLELVEPIAWDERTQPIPL-PLV----PMQPGD 154
            ..|..    .:|.|. |..|::..  .::|||||.|..||......:||.| |:|    .:|.|.
Zfish   318 IEGTEQNVDVIKLIS-HPRYNSKVSLFNHDIALLRLRSPIRLTPTVRPICLGPMVFSNTLLQSGT 381

  Fly   155 EVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDED----CDVGHICTFSRLGEGACHG 215
            ...::|||.....|.|...||.:.|.||....||...|:...    | .||    |...:.||.|
Zfish   382 LATVSGWGRVRFQGRSAATLQKIELPYVDRTVCKESSSDPITHFMFC-AGH----SDSPKDACQG 441

  Fly   216 DSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVM 259
            |||||.|    :..:|.|:::||..|| .|...|:..|..|..||::.|
Zfish   442 DSGGPHVMRYHNTWFLTGIISWGEECAKKGKYGVYTQVGNYYRWIQHTM 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/238 (33%)
Tryp_SPc 38..258 CDD:238113 80/240 (33%)
f9aNP_878288.2 GLA 19..83 CDD:214503
EGF_CA 84..120 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 253..486 CDD:214473 79/238 (33%)
Tryp_SPc 254..489 CDD:238113 80/240 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.