DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG8172

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:256 Identity:73/256 - (28%)
Similarity:121/256 - (47%) Gaps:24/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRFY-KDQRIIGGQAAEDGFAPYQISL--QG-ISGAHSCGGAIINETFVLTAAHCVENAFIPWLV 90
            |..| :..||:||.:...|..|:|::|  .| ::...|||||:|:..:|:||||||  |..|...
  Fly   307 GEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCV--ASTPNSN 369

  Fly    91 VVTGTNKYNQPG-------GRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPL-PL 147
            :.....:::..|       ..|.::...:|.:|:..:..||:||:.|...:.:.:...|:.| |.
  Fly   370 MKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPS 434

  Fly   148 VPMQPGDEVILTGWGSTVL-WGTSPIDLQVLYLQYVPHREC----KALLSNDEDCDVGHICTFSR 207
            .....|....:.|||.|.. ..|.|..||.:.::.:.:..|    :|....:...||.....:..
  Fly   435 TTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKD 499

  Fly   208 LGEGACHGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGNS 263
            .|..:|.|||||||.    ....|:|||:||..|. ..:|.|:.::..:..||..||:.::
  Fly   500 GGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVMANDN 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 67/238 (28%)
Tryp_SPc 38..258 CDD:238113 68/240 (28%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 67/238 (28%)
Tryp_SPc 316..555 CDD:238113 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.