DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and flz

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:253 Identity:77/253 - (30%)
Similarity:120/253 - (47%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISLQ-----GISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVT 93
            |..||:||:.:..|..|:|:.::     |:...:.|||.:|...:|:||||| :..|:..||.|.
  Fly  1445 KSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC-QPGFLASLVAVM 1508

  Fly    94 GTNKYNQPGG-------RYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL-VPM 150
            |  :::..|.       ...:|.:.:|..||.....||:|||||..|:.:|....||.:|. |..
  Fly  1509 G--EFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVAD 1571

  Fly   151 QPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH--------ICT-FS 206
            ..|....:||||.....|..|..||.:.:..:.:..|:.:...     .||        :|. ::
  Fly  1572 FTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHT-----AGHNKKILTSFLCAGYA 1631

  Fly   207 RLGEGACHGDSGGPLV----SNGY-LVGLVNWGWPCATG-VPDVHASVYFYRDWIRNV 258
            ...:.:|.||||||||    ...| |.|.|:.|..||.. :|.|:....||:.|:|::
  Fly  1632 NGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSI 1689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/245 (30%)
Tryp_SPc 38..258 CDD:238113 75/247 (30%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 75/247 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.