DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Jon44E

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:286 Identity:81/286 - (28%)
Similarity:121/286 - (42%) Gaps:50/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGL--SGLV---SITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISG 60
            |...|.|..|.:  :|:|   |..|:.:|.....|:.  :.||..|..|.:|..||.:.|....|
  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKI--EGRITNGYPAYEGKIPYIVGLSFNDG 63

  Fly    61 AHSCGGAIINETFVLTAAHCVENA----------------FIPWLVVVTGTNKYNQPGGRYFLKA 109
            .:.|||:||:.|:|||||||..:|                :..|   |:.::....|....||  
  Fly    64 GYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHW---VSRSDMIQHPDWNDFL-- 123

  Fly   110 IHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP----LVPMQPGDEVILTGWGSTVLWGTS 170
                        :|||||:.:.....| .....:.||    ......|...:.:|||.|......
  Fly   124 ------------NNDIALIRIPHVDFW-SLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGM 175

  Fly   171 PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV--SNGYLVGLVNW 233
            ...|..:.:|.:.:.:|:....::...| ..||..:..|:.:|.||||||||  .|..:||:|::
  Fly   176 SNYLNCVDVQIIDNNDCRNYYGSNYITD-NTICINTDGGKSSCSGDSGGPLVLHDNNRIVGIVSF 239

  Fly   234 --GWPCATGVPDVHASVYFYRDWIRN 257
              |..|..|.|.....|..|.||||:
  Fly   240 GSGEGCTAGRPAGFTRVTGYLDWIRD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/241 (28%)
Tryp_SPc 38..258 CDD:238113 70/244 (29%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 68/241 (28%)
Tryp_SPc 41..266 CDD:238113 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.