DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG30371

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:271 Identity:83/271 - (30%)
Similarity:129/271 - (47%) Gaps:21/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGI--SGAHSCGGAIINETFVLT 76
            |....|...:|.|...| :....||..||.|.....|...:|:.:  :.|..|||.|:...::||
  Fly   127 GSFKCTLTTVKQNCNCG-WSATTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILT 190

  Fly    77 AAHCV-ENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI-----HCNY-DNPEMHNDIALLELVEPI 134
            ||||: :.:....:|.:.|||....|....:.:..:|     |..| .:|:::||||:|.....|
  Fly   191 AAHCIYQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNI 255

  Fly   135 AWDERTQPIPLPLVPMQPG---DEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDED 196
            .|.....||.||.|.....   |.|.:.|:|:....|.:...||.:.|..|.:::|:...:|...
  Fly   256 QWSRGVGPICLPPVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVAT 320

  Fly   197 CDVGHICTFSRLGEG--ACHGDSGGPLV---SNGYLVGLVNWGWPCA-TGVP-DVHASVYFYRDW 254
            ...|.:||:...|.|  :|..|||||::   |..:|||::::|..|| :..| .|:..:..|..|
  Fly   321 IYTGQMCTYDYSGTGRDSCQFDSGGPVILRKSRQFLVGIISYGKSCAESQYPMGVNTRITSYISW 385

  Fly   255 IRNVMSGNSKC 265
            ||..: |||.|
  Fly   386 IRQKI-GNSNC 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/236 (30%)
Tryp_SPc 38..258 CDD:238113 73/238 (31%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 71/236 (30%)
Tryp_SPc 150..389 CDD:238113 73/238 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.