DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and KLK3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:256 Identity:79/256 - (30%)
Similarity:112/256 - (43%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            ||:||...|....|:|: |....|...|||.:::..:|||||||:.|.    .|::.|.:....|
Human    24 RIVGGWECEKHSQPWQV-LVASRGRAVCGGVLVHPQWVLTAAHCIRNK----SVILLGRHSLFHP 83

  Fly   102 --GGRYFLKAIHI--HCNYDNPEMHN-----------DIALLELVEPIAWDERTQPIPLPLVPMQ 151
              .|:.| :..|.  |..||...:.|           |:.||.|.||....:..:.:.||.....
Human    84 EDTGQVF-QVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPA 147

  Fly   152 PGDEVILTGWGS----TVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRL---- 208
            .|.....:||||    ..|   :|..||.:.|.         ::|||. |...|....::.    
Human   148 LGTTCYASGWGSIEPEEFL---TPKKLQCVDLH---------VISNDV-CAQVHPQKVTKFMLCA 199

  Fly   209 -----GEGACHGDSGGPLVSNGYLVGLVNWG-WPCATGV-PDVHASVYFYRDWIRNVMSGN 262
                 |:..|.||||||||.||.|.|:.:|| .|||... |.::..|..||.||::.:..|
Human   200 GRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVAN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/247 (31%)
Tryp_SPc 38..258 CDD:238113 77/249 (31%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 77/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.