DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss21

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:259 Identity:82/259 - (31%)
Similarity:119/259 - (45%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV--ENAFIPWLV----VVTGT 95
            ||:||:.||.|..|:|.||: :.|.|.||..::|..:|||||||.  :|....|.|    :.:..
  Rat    57 RIVGGEEAELGRWPWQGSLR-VWGNHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRP 120

  Fly    96 NKYNQP--GGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPL--PLVPMQPGDEV 156
            :.:|..  ..||.::.|.:...|.....| |||||:|..|:.:....|||.|  .........:.
  Rat   121 SLWNLQAYSNRYQIEDIFLSPKYTEQFPH-DIALLKLSSPVTYSNFIQPICLLNSTYKFANRTDC 184

  Fly   157 ILTGWGSTVLWGTS-----PIDLQVLYLQYVPHRECKALLS---------NDEDC----DVGHIC 203
            .:||||:.   |..     |.:||.:.:..:.:..|..|..         .|..|    :.|...
  Rat   185 WVTGWGAI---GEDESLPLPNNLQEVQVAIINNTMCNHLFKKPDFRINIWGDMVCAGSPEGGKDA 246

  Fly   204 TFSRLGEGACHGDSGGPLVSN----GYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            .|::|...|..||||||||.|    .|.||:|:||..|. ...|.|:.::..:.:|||..|..|
  Rat   247 CFAKLTYAAPQGDSGGPLVCNQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWIRLTMIRN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/250 (31%)
Tryp_SPc 38..258 CDD:238113 79/252 (31%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 77/250 (31%)
Tryp_SPc 58..304 CDD:238113 77/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.