DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG17572

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:282 Identity:67/282 - (23%)
Similarity:102/282 - (36%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RIKGNS-TDGRFYKDQRIIGGQAAEDGFAPY----QISLQGISG---AHSCGGAIINETFVLTAA 78
            ::.|.| ..|.|||            |...|    :|..:.::.   |:.|.||:|....:||||
  Fly   122 QVCGKSLVQGHFYK------------GLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAA 174

  Fly    79 HCVENAFIPWLVVVTGTNKYNQPGGRY---------------------FLKAIHIHCNYDNPEMH 122
            ||.       |....|....:...|.|                     .:..:.:|.:|...:.|
  Fly   175 HCA-------LAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYH 232

  Fly   123 NDIALLELVEPIAWDERTQPIPL--PLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHR 185
            :|||||.|..|:.:...||||.|  ....:..|....:.|||.   ..||.:....:....||..
  Fly   233 HDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGK---MSTSSVRQPEMSHLDVPLT 294

  Fly   186 ECKALLSN---------DEDCDVGHICTFSRLGEGACHGDSGGPLV--SNGYL--VGLVNWGWPC 237
            .....|.|         ....:...:|.... |:..|.|..|.||.  .||..  :|::::|...
  Fly   295 SWDLCLRNYGSTGALESPNSIEGQWMCAGGE-GKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDN 358

  Fly   238 ATG--VPDVHASVYFYRDWIRN 257
            ..|  :|.|:.||..:.:||.:
  Fly   359 CGGLRIPSVYTSVAHFSEWIHD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 59/262 (23%)
Tryp_SPc 38..258 CDD:238113 61/265 (23%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 60/254 (24%)
Tryp_SPc 138..378 CDD:214473 58/250 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.