DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG18478

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:294 Identity:74/294 - (25%)
Similarity:116/294 - (39%) Gaps:63/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLS--------------GLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQIS 54
            :|.|.:||::              |..:..|::::.|.|:|:            |:....|:.|:
  Fly     8 IVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQFNVTEGQ------------AKPAEFPWTIA 60

  Fly    55 L---QGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRY-----FLKAIH 111
            :   :.:.|    ||::|....||||||.:.|..:..:||..|..:|.....:|     |:..:.
  Fly    61 VIHNRSLVG----GGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMV 121

  Fly   112 IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ-PGDEVILTGWG----STVLWG--T 169
            ||.:::.....|::|||.|........:...|.||..... .....|:.|||    |...:|  .
  Fly   122 IHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVL 186

  Fly   170 SPIDLQVLYLQYVPHREC-----KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV------- 222
            ..|||.:     ||...|     |..|..:.....|.||........||.||.||.|.       
  Fly   187 KKIDLPI-----VPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDP 246

  Fly   223 SNGYLVGLVNWGWPC-ATGVPDVHASVYFYRDWI 255
            .....:|:||||..| ...||..:..|:.::.||
  Fly   247 KQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 63/245 (26%)
Tryp_SPc 38..258 CDD:238113 65/246 (26%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 65/240 (27%)
Tryp_SPc 50..280 CDD:214473 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.