DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Send2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:265 Identity:93/265 - (35%)
Similarity:133/265 - (50%) Gaps:44/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINE 71
            |:||.|:.|.:...||           .::||||||......||:|:|:|. .|.|.|||:|.:.
  Fly     7 LLLLALNSLSAGPVIR-----------PEERIIGGQPIGIEEAPWQVSIQR-DGKHLCGGSIYSA 59

  Fly    72 TFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAW 136
            ..::||||||:.   ....|..|:...|..|....:.||..|     ..:.||||::.|.:|:.:
  Fly    60 DIIITAAHCVQG---QGYQVRAGSALKNSNGSVVDVAAIRTH-----EGLGNDIAIVRLSKPLEF 116

  Fly   137 DERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQ--VLYLQYVPHRECKALLSNDEDC-- 197
            ..:.|||||......||....::||||:..: :.|||||  .||:|: |:.           |  
  Fly   117 TNQVQPIPLAKTNPPPGSIAFVSGWGSSSYY-SHPIDLQGVNLYIQW-PYY-----------CGL 168

  Fly   198 -DVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRN---- 257
             :...||..| .|..||.||||||||.:..|||:|:.|....| ...::.||.::|:||.|    
  Fly   169 TEPSRICAGS-FGRAACKGDSGGPLVFDQQLVGVVSGGTKDCT-YSSIYTSVPYFREWILNAIDE 231

  Fly   258 VMSGN 262
            :||.|
  Fly   232 IMSAN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/222 (36%)
Tryp_SPc 38..258 CDD:238113 82/228 (36%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 80/222 (36%)
Tryp_SPc 27..225 CDD:238113 79/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.