DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Phae2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:244 Identity:76/244 - (31%)
Similarity:106/244 - (43%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVEN-------AFIPWLVVVTG 94
            |::||:||....|||.:|:| ..|.|.|...|||..:::|||||:.|       ..:...:.|.|
  Fly    31 RVVGGKAAAANSAPYIVSMQ-YGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAG 94

  Fly    95 TNKYNQPGGRYFLKAIHIHCN--YDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVI 157
            |....|.     .:..|...|  |....:..||.|:.......|.....|:.||...::|..:..
  Fly    95 TASTTQK-----RQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKAD 154

  Fly   158 LTGWGSTVLWGTS--PIDLQ-VLYLQYVPHRECKALL-SNDEDCDVGHICTFSRL-GEGACHGDS 217
            |.|||||....:.  |..|| ...:..:....|.|.| |..:|....::||.... |...|..||
  Fly   155 LFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDS 219

  Fly   218 GGPLVSNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRDWIRNVMSGNSK 264
            |||||....|:|:|:|| .||. ...|.|:..|..:..||    :.|.|
  Fly   220 GGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI----AANQK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/233 (31%)
Tryp_SPc 38..258 CDD:238113 73/235 (31%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 72/233 (31%)
Tryp_SPc 32..262 CDD:238113 73/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.