DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Try29F

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:262 Identity:86/262 - (32%)
Similarity:130/262 - (49%) Gaps:15/262 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLSGLV---------SITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            :||:|:.         .|..:.:...:|..|...|.||:|||.|.....|||:|||  ...|.||
  Fly     5 IGLTGMAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ--RSYHFCG 67

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLEL 130
            |::|.:.:|||||||.|.:.|....|..|:::.:..|....:|.:|.|..:|...:..|.:||||
  Fly    68 GSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLEL 132

  Fly   131 VEPIAWDERTQPIPLPL--VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSN 193
            .|..|.:.....:.||.  ..:..|..|:::|||:|.....:...|:.:.:..|...:|.....|
  Fly   133 EEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGN 197

  Fly   194 DEDCDVGHICT-FSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIR 256
            ........:|. ....|:.||.|||||||.::|.|.|:|:||:.|| ...|.|::.|...||||.
  Fly   198 FGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWIS 262

  Fly   257 NV 258
            :|
  Fly   263 SV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/221 (34%)
Tryp_SPc 38..258 CDD:238113 77/223 (35%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 76/221 (34%)
Tryp_SPc 42..264 CDD:238113 77/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.