DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and PRSS38

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:292 Identity:86/292 - (29%)
Similarity:138/292 - (47%) Gaps:55/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAVVLLILLGLSGLVSITA----------IRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ 56
            ||:.||:||.:.....:.|          |.:.|:...||...:.:|:||..|.:...|:|:|:.
Human    14 SALGLLLLLLVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKILGGVPAPERKWPWQVSVH 78

  Fly    57 GISGAHSCGGAIINETFVLTAAHC--------VENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIH 113
             .:|.|.|||:|:||.:||:||||        :.:.:: .||.:.....:.|   .|.:..:.:|
Human    79 -YAGLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMYV-GLVNLRVAGNHTQ---WYEVNRVILH 138

  Fly   114 CNYDNPEMHN----DIALLELVEPIAWDERTQPIPL--PLVPMQPGDEVILTGWGSTVLWGTSPI 172
            ..|   ||::    |:||::|...|.:.|...|:.|  |.|.:...: ...||||.....|.:..
Human   139 PTY---EMYHPIGGDVALVQLKTRIVFSESVLPVCLATPEVNLTSAN-CWATGWGLVSKQGETSD 199

  Fly   173 DLQVLYLQYVPHRECKALLSNDEDCDVGH--------ICTFSRL-GEGACHGDSGGPLV---SNG 225
            :||.:.|..:....|..|        .||        :|....| .:..|.||||||||   :..
Human   200 ELQEMQLPLILEPWCHLL--------YGHMSYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRS 256

  Fly   226 YL-VGLVNWGWPCATGV-PDVHASVYFYRDWI 255
            :| :|:|:||..|:..: |.|:|||.::..||
Human   257 WLQIGIVSWGRGCSNPLYPGVYASVSYFSKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/245 (30%)
Tryp_SPc 38..258 CDD:238113 75/246 (30%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.