DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG31954

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:237 Identity:85/237 - (35%)
Similarity:125/237 - (52%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            |.||:||.......||:|:|||  :.:|.|||:||:|.::||||||........|.|..||:::.
  Fly    48 DGRIVGGHRINITDAPHQVSLQ--TSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFA 110

  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ--PGDEVILTGWG 162
            :.|....::.|..|..::...:..|.:||:|..||.:||..:.:.||...|:  .|:...::|||
  Fly   111 RSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWG 175

  Fly   163 STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH----------ICT-FSRLGEGACHGD 216
            :|          |.|.......|:.:..|.|.|.|...:          ||. |...|:.||.||
  Fly   176 NT----------QNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGD 230

  Fly   217 SGGPLVS-NGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIR 256
            ||||:|| :|.|||:|:||:.|| ...|.|::.|.|.||||:
  Fly   231 SGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 82/232 (35%)
Tryp_SPc 38..258 CDD:238113 83/234 (35%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 82/232 (35%)
Tryp_SPc 51..274 CDD:238113 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.