DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Send1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:231 Identity:81/231 - (35%)
Similarity:120/231 - (51%) Gaps:30/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ 100
            :|||||.:.:....|:|:||| ..|.|.|||:|.::|.::|||||::..   ...:..|::.::.
  Fly    28 ERIIGGSSMDITDVPWQVSLQ-YYGEHFCGGSIYSKTIIITAAHCIKEG---ERSIRAGSSLHDS 88

  Fly   101 PGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTV 165
            .|....::|..||..:|...|.||:|:|:|..|:::.:..|.|||...........:.||||.  
  Fly    89 GGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIPLAETDPPTSSSALATGWGR-- 151

  Fly   166 LWGT---SPIDLQVLYLQYVPHRECKALLSN---DEDCDVGHICTFSRLGEGACHGDSGGPLVSN 224
              |.   .|..||.:.:...|...||....|   :||     ||. .|:|:|.|:||||||||.|
  Fly   152 --GNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNED-----ICA-GRMGKGGCYGDSGGPLVFN 208

  Fly   225 GYLVGLVNWGWPCATG-----VPDVHASVYFYRDWI 255
            |.|||:.:     .||     ...::|||..||:||
  Fly   209 GQLVGITS-----RTGNIVCLGSSLYASVARYRNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/228 (35%)
Tryp_SPc 38..258 CDD:238113 80/229 (35%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 79/228 (35%)
Tryp_SPc 30..239 CDD:238113 78/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.