DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Ser12

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:268 Identity:85/268 - (31%)
Similarity:124/268 - (46%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINE 71
            ::|..|..:.|:|.|. .|:|       .:||:||........|:|.:|. .|..:.||..|.::
  Fly     1 MLLHWLVLVASVTLIS-AGSS-------PERIVGGHPVLISEVPWQAALM-YSEKYICGAVIYSD 56

  Fly    72 TFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNY-DNPEMHNDIALLELVEPIA 135
            ..::|||||||..|.....|..|:...|..|....:..|..|.:| .:..:.||||::.||:.:.
  Fly    57 KIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLI 121

  Fly   136 WDERTQPIPLPLVPMQPGDEVILTGWGST-VLW--GTSPIDLQVLYL---------QYVPHRE-C 187
            ::...:||.|.......|.|..::|||.. :||  .||.:...|..|         ||:.... |
  Fly   122 FNAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYITKTMIC 186

  Fly   188 KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATG-VPDVHASVYFY 251
            .|.|..|                 :|||||||||||.|.|||:|::|..||.. .|.|:|:|...
  Fly   187 AAALLKD-----------------SCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAEL 234

  Fly   252 RDWIRNVM 259
            :.||.|.:
  Fly   235 KPWILNAI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/232 (32%)
Tryp_SPc 38..258 CDD:238113 76/234 (32%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 75/232 (32%)
Tryp_SPc 24..238 CDD:238113 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.