DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG11911

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:79/258 - (30%)
Similarity:115/258 - (44%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISL--QGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ 100
            :|.|..||...|||.:||  ..:..:|.|||.:||:.:::|||||:                 ::
  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI-----------------SE 84

  Fly   101 PGGRYFLKAIH------------------IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL 147
            |.|...:..:|                  :|..|.......|||||.:.|...::|..||..||.
  Fly    85 PVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPS 149

  Fly   148 VPMQPGDEVILTGWG---STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFS-RL 208
            .......|..|.|||   |.:..|..  .||.:..|.:.:.|||..|.........:||:.| :.
  Fly   150 REQVHEGETHLYGWGQPKSYIFSGAK--TLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQ 212

  Fly   209 GEGACHGDSGGPLV-----SNGYLVGLVNWGW-PCA-TGVPDVHASVYFYRDWIRNVMSGNSK 264
            .:.||:||||||||     :...|:|:|:||: ||. ..:|.::..|..|.|||.|:.|...|
  Fly   213 SKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNIQSAYYK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/247 (30%)
Tryp_SPc 38..258 CDD:238113 76/250 (30%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 76/250 (30%)
Tryp_SPc 37..266 CDD:214473 74/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.