DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG1304

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:274 Identity:93/274 - (33%)
Similarity:134/274 - (48%) Gaps:36/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |.:|...||||...|:....:.....|.:|      |::||:.|.....|:|:||:. :|:||||
  Fly     1 MRSVKAAILLGSFLLLLAVPVHSAPGSLNG------RVVGGEDAVKNQFPHQVSLRN-AGSHSCG 58

  Fly    66 GAIINETFVLTAAHCVENA-----FIP----WLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEM 121
            |:|::..:||||||||.|.     .:|    ...:..|:|.....|....:..:.:|..|.|  .
  Fly    59 GSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN--F 121

  Fly   122 HNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRE 186
            .||:|||.|..|:......|||.||........:||::|||.....|..|     .||||   ..
  Fly   122 LNDVALLRLESPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQGDLP-----RYLQY---NT 178

  Fly   187 CKALLSNDEDCD--VG-----HICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGW-PCATGVPD 243
            .|::  :.|.||  :|     .:|.......|||:||||||.|.|..:||:..:.| .|.|..||
  Fly   179 LKSI--SLERCDELIGWGVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPD 241

  Fly   244 VHASVYFYRDWIRN 257
            .:|.||::.:||:|
  Fly   242 GYARVYYHNEWIKN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 81/234 (35%)
Tryp_SPc 38..258 CDD:238113 83/237 (35%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 81/234 (35%)
Tryp_SPc 32..256 CDD:238113 83/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.