DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP010243

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_554157.3 Gene:AgaP_AGAP010243 / 3292148 VectorBaseID:AGAP010243 Length:275 Species:Anopheles gambiae


Alignment Length:227 Identity:77/227 - (33%)
Similarity:118/227 - (51%) Gaps:8/227 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPG 102
            |:||...:....|||:|::.:: .|.|||:||...:||||.|||::....::.|..|:..|.:.|
Mosquito    47 IVGGHVVDIEMHPYQVSVRELN-EHICGGSIITNRWVLTAGHCVDDTIAAYMNVRVGSAFYAKGG 110

  Fly   103 GRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP--LVPMQPGDEVILTGWGSTV 165
            ..:.:.::..|.::.......|.|||:|...|.:....|||.|.  |.......|.::||||.|:
Mosquito   111 TIHPVDSVTTHPDHVPYSWLADFALLQLKHAIVFSTIAQPIALAFRLDNALSDRECVVTGWGRTL 175

  Fly   166 LWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT--FSRLGEGACHGDSGGPLVSNGYLV 228
            ....|...|:.:.:..|....|.|  :.:...|...||.  |...|:|:|..|||||||.....|
Mosquito   176 NEEESFDKLRAVQIPLVSRVLCNA--TYEGKIDQTMICAGDFVDGGKGSCAYDSGGPLVCGDMQV 238

  Fly   229 GLVNWGWPCA-TGVPDVHASVYFYRDWIRNVM 259
            |:|:||..|| .|.|||::||.:.|.||.:::
Mosquito   239 GIVSWGKGCAMPGYPDVYSSVLYARAWINSIV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/221 (34%)
Tryp_SPc 38..258 CDD:238113 77/224 (34%)
AgaP_AGAP010243XP_554157.3 Tryp_SPc 47..269 CDD:238113 77/224 (34%)
Tryp_SPc 47..266 CDD:214473 75/221 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.