DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CLIPC1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_552698.3 Gene:CLIPC1 / 3291827 VectorBaseID:AGAP008835 Length:389 Species:Anopheles gambiae


Alignment Length:247 Identity:73/247 - (29%)
Similarity:110/247 - (44%) Gaps:26/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQGISGA----HSCGGAIINETFVLTAAHCVENA-FIPWLVVVTGTNK 97
            |:.|:.|:....|: ::|.|...|    :.|||:::::.|:|||.||:.:. |.|..:|..|...
Mosquito   143 IVDGELAKAREFPH-MALIGFGEAPEIRYLCGGSLVSDRFILTAGHCLTSTNFGPATIVRLGELS 206

  Fly    98 YNQPGGRYFLKAIHI-----HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVI 157
            ........|.:...|     |..|.....:|||||::|...:.:....:||.|||....|....|
Mosquito   207 LASSTDEAFPEDYDIAERIPHPEYKQTSHYNDIALIKLNRKVIFSPYARPICLPLQAAIPQKRAI 271

  Fly   158 LTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG-----HICTFSRLG-EGACHGD 216
            .||||:..........|..:.|......|||...........|     .:|..||.. :..|.||
Mosquito   272 ATGWGAIGFGLEQSSALLKVTLDMFRFEECKDQFEPTRKLRTGLNATTQLCAGSRNSTKDTCQGD 336

  Fly   217 SGGPLV----SNGY----LVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVM 259
            |||||.    :|.|    ::|:.::|..|. .|||.|:.:||.|..||.|::
Mosquito   337 SGGPLQVYNDANVYCTYTIIGVTSFGQNCGLAGVPAVYTTVYSYLSWIENLI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/241 (29%)
Tryp_SPc 38..258 CDD:238113 72/244 (30%)
CLIPC1XP_552698.3 CLIP 39..79 CDD:197829
Tryp_SPc 143..386 CDD:238113 72/243 (30%)
Tryp_SPc 143..384 CDD:214473 70/241 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.