DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TRY2_ANOGA

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_555167.1 Gene:TRY2_ANOGA / 3291694 VectorBaseID:AGAP008295 Length:277 Species:Anopheles gambiae


Alignment Length:235 Identity:83/235 - (35%)
Similarity:129/235 - (54%) Gaps:12/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RFYKD---QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVV 92
            |.::|   .|::||...:...||||:|||..: :|.|||::::..:|||||||.:......|.|.
Mosquito    41 RLHRDSNGHRVVGGFQIDVSDAPYQVSLQYFN-SHRCGGSVLDNKWVLTAAHCTQGLDPSSLAVR 104

  Fly    93 TGTNKYNQPGGRY--FLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP--LVPMQPG 153
            .|:::: ..||..  .|:.:. |..||...:..|.:|:||...:.:.:..||:.||  ..|::||
Mosquito   105 LGSSEH-ATGGTLVGVLRTVE-HPQYDGNTIDYDFSLMELETELTFSDAVQPVELPEHEEPVEPG 167

  Fly   154 DEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECK-ALLSNDEDCDVGHICTFSRLGEGACHGDS 217
            ....::|||:|.....|...|:...:..|.|.:|. |.:...|..|......:.:.|:.||.|||
Mosquito   168 TMATVSGWGNTQSAVESSDFLRAANVPTVSHEDCSDAYMWFGEITDRMLCAGYQQGGKDACQGDS 232

  Fly   218 GGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIR 256
            |||||::|.|||:|:||:.|| .|.|.|:..|...|||:|
Mosquito   233 GGPLVADGKLVGVVSWGYGCAQPGYPGVYGRVASVRDWVR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/223 (35%)
Tryp_SPc 38..258 CDD:238113 80/225 (36%)
TRY2_ANOGAXP_555167.1 Tryp_SPc 50..271 CDD:214473 79/223 (35%)
Tryp_SPc 51..274 CDD:238113 80/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.