DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:223 Identity:73/223 - (32%)
Similarity:113/223 - (50%) Gaps:3/223 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            ||:||..|..|.||:.:||:.....|.|||.:::..|||::|:|:........:.|.|:...|..
Mosquito    23 RIVGGIDAVAGDAPWMVSLRNSINQHLCGGTLLSNRFVLSSANCLSGRLATATMAVAGSRFLNTA 87

  Fly   102 GGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVL 166
            ...|:...|..|.|::...:.:|:||.:........:..||:||....:..|....:.|||::..
Mosquito    88 AIPYYGIQIITHPNFNVNTLEHDVALFQTALQFILTQSVQPLPLSADVIGVGVRARVFGWGASQA 152

  Fly   167 WGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG--HICTFSRLGEGACHGDSGGPLVSNGYLVG 229
            .|.:...||.|.:..:.:.:|...| ..|...:|  .:||.:|.|:|.|.||.||.||.:.|.:|
Mosquito   153 NGGNTNALQFLNVNTLSNDDCANFL-GAEGWRIGPSSLCTLTREGQGICGGDEGGALVLDNYAIG 216

  Fly   230 LVNWGWPCATGVPDVHASVYFYRDWIRN 257
            :.:||.|||||.|||...:...|.||.|
Mosquito   217 VASWGIPCATGRPDVFVRISAVRSWILN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/219 (32%)
Tryp_SPc 38..258 CDD:238113 72/222 (32%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 70/219 (32%)
Tryp_SPc 24..242 CDD:238113 69/218 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.