DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP004567

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_313871.5 Gene:AgaP_AGAP004567 / 3291034 VectorBaseID:AGAP004567 Length:321 Species:Anopheles gambiae


Alignment Length:238 Identity:76/238 - (31%)
Similarity:116/238 - (48%) Gaps:16/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTG 94
            ||.....||:||.||:....|:.:.|. ..||..|||::||:.:::|||||| .:|.|..::   
Mosquito    77 GRGKTSSRIVGGDAADVKEYPWIVMLL-YRGAFYCGGSLINDRYIVTAAHCV-LSFTPQQLL--- 136

  Fly    95 TNKYNQPGGRYFLKAI---HIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ-PGDE 155
            ...|:...|....:||   :.|..:.....:|||||::|.:|:.......||.||:.... .|..
Mosquito   137 AKLYDVEHGEMVTRAIVKLYGHERFSLDTFNNDIALVKLQQPVEAGGSFIPICLPVAGRSFAGQN 201

  Fly   156 VILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGG 219
            ..:.|||. :..|:....||...:..:.:.:|:.............:|. ::..|..||.|||||
Mosquito   202 GTVIGWGK-LANGSLSQGLQKAIVPIISNMQCRKSSYRASRITDNMLCAGYTEGGRDACQGDSGG 265

  Fly   220 PL---VSN-GYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRN 257
            ||   .|| ..|||:|:||..|| ...|.|:..|..|.:||::
Mosquito   266 PLNVGDSNFRELVGIVSWGEGCARPNYPGVYTRVTRYLNWIKS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/227 (32%)
Tryp_SPc 38..258 CDD:238113 73/230 (32%)
AgaP_AGAP004567XP_313871.5 Tryp_SPc 84..306 CDD:214473 72/227 (32%)
Tryp_SPc 85..309 CDD:238113 73/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.