DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP007262

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_564960.3 Gene:AgaP_AGAP007262 / 3290331 VectorBaseID:AGAP007262 Length:316 Species:Anopheles gambiae


Alignment Length:328 Identity:100/328 - (30%)
Similarity:146/328 - (44%) Gaps:77/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGL-----------------VSITAIR-------IKGN----STDGRFYKDQR 37
            |..|:.|.|:||..|                 :..:.:|       ||.:    :|..:...::|
Mosquito     1 MKCVISLTLVGLLALLHGVSPLPTTSSSSSFGIDWSEVRPIEEFDHIKAHFRTPTTATQNTPNRR 65

  Fly    38 IIGGQAAEDGFAPYQISLQG--ISGAHSCGGAIINETFVLTAAHCV---ENAFIPWLVVVTGT-- 95
            |:.||.|..|..|||::|.|  .||...||.:||.:.:||||||||   .:|..|   |..||  
Mosquito    66 IVNGQEARPGQFPYQVALLGQFNSGVGLCGASIITQRYVLTAAHCVYIGVDASTP---VANGTAI 127

  Fly    96 -----NKYNQPGGR---YFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP------ 146
                 ....:|..:   :....:..|..||..::.||||::.|.|||.:.:|.|||.||      
Mosquito   128 LGAHNRMIEEPSQQRITFSASGVIGHPGYDLFDVRNDIAVVRLDEPILYTDRIQPIRLPGRSDTR 192

  Fly   147 ----LVPMQPGDEVILTGWG--STVLWGTSPIDLQVLYLQYVPHRECKALLSNDE-DCDVGHICT 204
                |:.       .::|:|  ||...|.|.: |..:....:.:.:|:|..|..| ..:..::|.
Mosquito   193 TFAGLMG-------TVSGYGVYSTANPGLSDV-LNYVLNPVITNADCRAAWSGFEWLIEPQNVCQ 249

  Fly   205 FSRLGEGACHGDSGGPLV--SNG--YLVGLVNWG--WPCATGVPDVHASVYFYRDWIRNVMSGNS 263
            ....|..||:.||||||.  .||  ..||:|::|  ..|..|:|.|.|.|.:|.|||    ..||
Mosquito   250 SGDGGRSACNSDSGGPLTVQDNGESLQVGVVSFGSAGGCDNGIPTVFARVTYYLDWI----EANS 310

  Fly   264 KCT 266
            ..|
Mosquito   311 DFT 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 84/251 (33%)
Tryp_SPc 38..258 CDD:238113 85/253 (34%)
AgaP_AGAP007262XP_564960.3 Tryp_SPc 65..306 CDD:214473 84/251 (33%)
Tryp_SPc 66..309 CDD:238113 85/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.